Hunter funeral home obituaries. Obituary Notifications Signup info@hunterfuneralhome.
Hunter funeral home obituaries. Please join us in Loving, Sharing and Memorializing Linda Joyce Heady on this permanent online memorial. Dec 25, 2024 · View The Obituary For Beverly Diane King of Lebanon, Tennessee. Please join us in Loving, Sharing and Memorializing Millie Ashburn on this permanent online memorial. Read Hunter-Odom Funeral Services obituaries, find service information, send sympathy gifts, or plan and price a funeral in Rocky Mount, NC Sep 24, 2024 · View The Obituary For Charles Ray Wilkins of Sparta, Tennessee. Please join us in Loving, Sharing and Memorializing Hazel Grace Goodwin Dickerson on this permanent online memorial. View obituaries, order flowers for Hunter-Odom Fu Dec 29, 2024 · View The Obituary For Howard Leslie Thomason of Sparta, Tennessee. Sis. Read Hunter's Funeral Home - Murfreesboro obituaries, find service information, send sympathy gifts, or plan and price a funeral in Murfreesboro, NC Sep 20, 2024 · View The Obituary For Martha Sue Bell Broyles of Sparta, Tennessee. Please join us in Loving, Sharing and Memorializing Don Wilson on this permanent online memorial. Please join us in Loving, Sharing and Memorializing Beverly Diane King on this permanent online memorial. Read Hunter Funeral Home obituaries, find service information, send sympathy gifts, or plan and price a funeral in Whitmire, SC Jun 6, 2025 · Obituaries from Karpus-Hunter Funeral Home in Alpena, Michigan. So I thought I start a thread were people could add their own or what they found. The family will receive friends on Monday, December 30, 2024, from 6:00 PM to 8:00 PM at Hunter Funeral Home, 423 Warwoman Rd. I run those numbers and it looks like magic compared to even the Gold Medal SMK load. Obituaries from Hunter & Sons' Funeral Home in Whitmire, South Carolina. May 28, 2025 · View The Obituary For Don Wilson of Sparta, Tennessee. Please join us in Loving, Sharing and Memorializing Donnie Howard on this permanent online memorial. Feb 27, 2025 · View The Obituary For Hazel Grace Goodwin Dickerson of Sparta, Tennessee. Do any of you run these? If it’s anything close to claims it’s worth the expense, given a rifle that likes them. May 28, 2025 · View The Obituary For Evelyn Sapp Demps of Sparta, Tennessee. Obituary Notifications Signup info@hunterfuneralhome. Doug Benningfield and Thomas McCulley will officiate. Our experienced and compassionate staff of funeral directors are here to help families celebrate life with dignity and respect. The family will receive friends from 4-7:00pm Tuesday at Hunter Funeral Home. May 9, 2025 · View The Obituary For Sue Vinson Bray of Sparta, Tennessee. This is one of my favorites" The Deer Hunter's Prayer " - by Dale Sun Jan 28, 2025 · for a spincast and protein feeders. Jan 25, 2024 · View The Obituary For Bruce Allen Richardson of Sparta, Tennessee. Jun 29, 2025 · View The Obituary For Cindy Carol Gardner of Sparta, Tennessee. Ross Funeral Home Inc. Please join us in Loving, Sharing and Memorializing Ricky Hudson on this permanent online memorial. Please join us in Loving, Sharing and Memorializing Pinkie Hill on this permanent online memorial. Jul 26, 2025 · Honor your loved ones with a beautiful floral arrangement. Oct 30, 2024 · View The Obituary For Pinkie Hill of Sparta, Tennessee. Fred Hunter’s Funeral Home accommodates all types of services, from traditional funerals to celebrations of life, intimate gatherings to large events. Feb 21, 2025 · View The Obituary For Donna Jean Dennis Dilldine of Sparta, Tennessee. 24/7 ~ 204-202-7242 Home About Us Funeral Services Education & Planning Green Burial Resources & FAQ Jan 6, 2025 · Hunter Funeral Home has been entrusted with Howard's cremation and a memorial service will be conducted 7:00pm Thursday, January 9, 2025 from the Chapel of Hunter Funeral Home. Mags: $40 each or $140 for all. Please join us in Loving, Sharing and Memorializing Thelma June Nash Prater on this permanent online memorial. Diantha McLeod will officiate. Please join us in Loving, Sharing and Memorializing Jeffrey Glynn Green on this permanent online memorial. Dec 24, 2024 · View The Obituary For Jimmy Miller of Sparta, Tennessee. Apr 4, 2024 · View The Obituary For Butch Simmons of Cookeville, Tennessee. What are y'alls experience and thoughts when looking to purchase a new 350-600 lb spincast and maybe a small protein feeder to go along side of it? This subject has been broached before, but let's get an update on what's out there and the pros and cons The original Texas Hunting Forum – discuss deer, quail, duck, goose, turkey, hog and everything else we hunt in Texas, buy and sell in the classifieds or just shoot the bull with like minded folks! The original Texas Hunting Forum - discuss deer, quail, duck, goose, turkey, hog and everything else we hunt in Texas, buy and sell in the classifieds or just shoot the bull with like minded folks! Dec 4, 2021 · The original Texas Hunting Forum - discuss deer, quail, duck, goose, turkey, hog and everything else we hunt in Texas, buy and sell in the classifieds or just shoot the bull with like minded folks! Jan 9, 2025 · For sale is a Tikka long action Stockys hunter type stock with aluminum bedding block and factory bottom metal. View The Obituary For JR Young of Sparta, Tennessee. View The Obituary For Michael Henderson of Sparta, Tennessee. Apr 3, 2024 · View The Obituary For Cathy Irene Parks Lance of Crossville, Tennessee. Oct 27, 2024 · View The Obituary For Elise Brown Morris of Sparta, Tennessee. May 11, 2025 · View The Obituary For Linda Joyce Heady of Sparta, Tennessee. To order memorial trees or send flowers to the family in memory of Sherry Lynn Carter, please visit our flower store. Read Higgins Funeral Home at Hunter-Allen Myhand Funeral Home obituaries, find service information, send sympathy gifts, or plan and price a funeral in Lagrange, GA Apr 21, 2025 · View The Obituary For Johnnie Dale Brown of Sparta, Tennessee. Aug 25, 2023 · View The Obituary For Julie Harrison of Watertown, Tennessee. FTF Fort Worth or could ship on buyers dime. Please join us in Loving, Sharing and Memorializing Charles Ray Wilkins on this permanent online memorial. Mar 16, 2025 · View The Obituary For Darlene Zinsky of Sparta, Tennessee. Jul 23, 2025 · The original Texas Hunting Forum - discuss deer, quail, duck, goose, turkey, hog and everything else we hunt in Texas, buy and sell in the classifieds or just shoot the bull with like minded folks! Sep 24, 2013 · I read a article last year and it had some pretty cool hunting prayers, poems and such. L. Please join us in Loving, Sharing and Memorializing Johnnie Dale Brown on this permanent online memorial. We provide a variety of service offerings designed to meet your family's customs and traditions, including View Recent Obituaries for Hunter Funeral Home. Jan 4, 2025 · View The Obituary For Paul "Buddy" Taylor of Lebanon, Tennessee. Obituary Notifications Signup info@hunterfuneralhome. Funeral service 1:00 pm Tuesday, July 8, 2025 at Hunter-Odom Funeral Service, 121 S. Read Hunter's Funeral Home - Ahoskie obituaries, find service information, send sympathy gifts, or plan and price a funeral in Ahoskie, NC Aug 2, 2025 · View recent services at our funeral home in Clayton, GA and honor your loved ones with a beautiful floral arrangement by visiting our obituary page. To advertise, call 412-614-9659 or email mckeesportobituaries@gmail. Discover compassionate funeral and cremation services at Hunter-Odom Funeral Services in Rocky Mount, NC. Please join us in Loving, Sharing and Memorializing Jimmy Miller on this permanent online memorial. Apr 28, 2025 · The Worthington family has entrusted Hunter Funeral Home with Anita's cremation and a memorial service will be conducted 1:00pm Saturday, May 3, 2025 from the Chapel of Hunter Funeral Home. Please join us in Loving, Sharing and Memorializing Ronnie Wayne Nash on this permanent online memorial. Discover compassionate funeral and cremation services at Hunter Funeral Home in Clayton, GA. Please join us in Loving, Sharing and Memorializing Mary Elizabeth Heady Finley on this permanent online memorial. Please join us in Loving, Sharing and Memorializing Michael Henderson on this permanent online memorial. Oct 21, 2024 · View The Obituary For Doug Austin of Lost Creek, Tennessee. You can also send flowers or thoughtful gifts to commemorate your loved ones. View The Obituary For Jennifer Marie Merrell of Sparta, Tennessee. Please join us in Loving, Sharing and Memorializing R. Please join us in Loving, Sharing and Memorializing Howard Leslie Thomason on this permanent online memorial. Is this normal (see pic below)? Before, I had been using Moultrie feeders where you don't control the spinn Feb 8, 2024 · I was looking at Hornady’s 168 grain Superformance Match load. Visit our obituary page to view recent services at our funeral home in Sparta, TN. Read Hunter Edmundson Striffler Funeral Home obituaries, find service information, send sympathy gifts, or plan and price a funeral in McKeesport, PA May 17, 2022 · Obituaries from Hunter-Anderson Funeral Home in Berkeley Springs, West Virginia. Aug 31, 2021 · My daughters (8yo and 11yo) have spent a bunch of time with me in the woods hunting but this year I want to give them a chance to pull the trigger on a white tail. The family will receive friends after 4:00pm Thursday at Hunter Funeral Home. Please join us in Loving, Sharing and Memorializing Bruce Allen Richardson on this permanent online memorial. Please join us in Loving, Sharing and Memorializing Evelyn Sapp Demps on this permanent online memorial. Aug 1, 2025 · Hunter Funeral Home, Inc. One 3 round and three 5 rounders. Contact us to learn how to plan for yourself or someone you love. View The Obituary For Erin Leigh Foster of Sparta, Tennessee. Please join us in Loving, Sharing and Memorializing Erin Leigh Foster on this permanent online memorial. Please join us in Loving, Sharing and Memorializing Linda Sue Narramore on this permanent online memorial. Please join us in Loving, Sharing and Memorializing Gaylord John Mlsna on this permanent online memorial. Burial will follow at Pickett Cemetery. Oct 16, 2024 · View The Obituary For Carol Janette Price of Sparta, Tennessee. Feel free to share your condolences with the family through the funeral home's website: www. View Recent Obituaries for Hunter Funeral Home. I have read lots of articles abou Nov 7, 2024 · View The Obituary For R. Please join us in Loving, Sharing and Memorializing Butch Simmons on this permanent online memorial. Please join us in Loving, Sharing and Memorializing Jennifer Marie Merrell on this permanent online memorial. Aug 12, 2025 · Obituaries from Hunter's Funeral Home in Ahoskie, North Carolina. May 4, 2025 · View The Obituary For Nancy Joan Poteet Eller of Leesburg, Georgia. Jun 13, 2025 · View The Obituary For Mary Elizabeth Heady Finley of Sparta, Tennessee. Eugenie Edge, 82, passed away Thursday, July 3, 2025. Please join us in Loving, Sharing and Memorializing Nancy Joan Poteet Eller on this permanent online memorial. Please join us in Loving, Sharing and Memorializing Darlene Zinsky on this permanent online memorial. Hansel was born December 18, 1944, in Clayto Nov 18, 2023 · View The Obituary For William Robert Harris of Crossville, Tennessee. net 120 East Bockman Way Sparta, Tennessee 38583 (931) 836-3211 (931) 836-3212 Dec 28, 2024 · Funeral services will be held on Tuesday, December 31, 2024, at 2:00 PM in the Chapel of Hunter Funeral Home, with Shane Watts officiating. Please join us in Loving, Sharing and Memorializing Jeffrey Hayes Daniel on this permanent online memorial. Offer condolences/tributes, send flowers or create an online memorial for free. of Ahoskie, NC departed this life on Wednesday, November 17, 2021, at his residence. Henry Moore, Jr. The family will receive friends after 11:00am Saturday at Hunter Funeral Home. Stock: $150 I also have 4 Tikka LA factory magazines. Battle,… Aug 4, 2025 · Obituaries from Hunter Funeral Home in Sparta, Tennessee. View obituaries, order flowers for Hunter Funeral Home - (706) Read Fred Hunter's Funeral Home, Cemeteries, and Crematory - Hollywood obituaries, find service information, send sympathy gifts, or plan and price a funeral in Hollywood, FL Nov 17, 2023 · View The Obituary For Ricky Hudson of Murfreesboro, Tennessee. hunterfuneralhomega. It seems to me that the feeder is dumping a lot of corn directly under the feeder instead of throwing it out more. Aug 11, 2025 · View Henderson obituaries on Legacy, the most timely and comprehensive collection of local obituaries for Henderson, North Carolina, updated regularly throughout the day with submissions from Leon Alexander Parks Jul 31, 2025 Visit Obituary Jacqueline Chamblee Manley Aug 12, 2025 Visit Obituary Derrick "D. Please join us in Loving, Sharing and Memorializing Martha Sue Bell Broyles on this permanent online memorial. provides complete funeral services in Alpena, M. Read Fred Hunter's Funeral Home, Cemeteries, and Crematory - Davie Cooper City obituaries, find service information, send sympathy gifts, or plan and price a funeral in Davie, FL Jun 10, 1994 · Hunter Funeral Home Mike & Kathy Hunter, Owners Welcome to Hunter Funeral Home, proudly serving Watertown and the surrounding communities since 1965. Working together, Fred Hunter’s Funeral Home and Hollywood Memorial Gardens give families the convenience of planning a funeral or celebration and cemetery memorial all in one place. View The Obituary For Stephanie Ann Bly of Smithville, Tennessee. A. Please join us in Loving, Sharing and Memorializing Elise Brown Morris on this permanent online memorial. Jan 16, 2024 · View The Obituary For Donnie Howard of Sparta, Tennessee. Fairview Road, Rocky Mount, NC. I have read lots of articles abou Jul 23, 2025 · The original Texas Hunting Forum - discuss deer, quail, duck, goose, turkey, hog and everything else we hunt in Texas, buy and sell in the classifieds or just shoot the bull with like minded folks! Sep 24, 2013 · I read a article last year and it had some pretty cool hunting prayers, poems and such. Please join us in Loving, Sharing and Memorializing Debbie Hutchings on this permanent online memorial. E. I am going to get them a compact rifle as they are not comfortable using my AR and bolt gun. Please join us in Loving, Sharing and Memorializing Sue Vinson Bray on this permanent online memorial. Fairview Road, Rocky Mount, NC 27801 with Pastor Mack E. Jun 20, 2025 · View The Obituary For Jeffrey Hayes Daniel of Walling, Tennessee. 27801 with Reverend James Williams,… Aug 3, 2025 · Search obituaries and death notices from Ahoskie, North Carolina, brought to you by Echovita. Hunter Funeral Home announces the passing of William Arthur Young of Clayton. We are dedicated to serving our community with dignity and an enduring commitment u2028to a high standard of service. and Queen Esther Twine Moore. Jul 23, 2025 · Oak Lawn is a complete, full-service funeral home and cemetery that will meet all your funeral and burial needs. View The Obituary For Mary June Brown Mitchell of Sparta, Tennessee. 2 days ago · A free service of Tube City Online and your McKeesport-area funeral professionals. Find contact information, view maps, and more. Guy of Sparta, Tennessee. Please join us in Loving, Sharing and Memorializing Cathy Irene Parks Lance on this permanent online memorial. Please join us in Loving, Sharing and Memorializing Julie Harrison on this permanent online memorial. Funeral service 1:00 pm, Thursday, July 17, 2025 at Hunter-Odom Funeral Service, 121 S. Battle,… Celebrate the beauty of life by recording your favorite memories or sharing meaningful expressions of support on your loved one's social obituary page. Please join us in Loving, Sharing and Memorializing Paul "Buddy" Taylor on this permanent online memorial. Aug 24, 2024 · View The Obituary For Jeffrey Glynn Green of Sparta, Tennessee. Jan 24, 2020 · About a month ago, I bought a stand and fill feeder at Academy. Mar 30, 2023 · View upcoming funeral services, obituaries, and funeral flowers for Karpus Hunter & Ross Funeral Home in Alpena, MI, US. is here in Sparta where we've been since 1891. Please join us in Loving, Sharing and Memorializing Garry Gean Burson on this permanent online memorial. See MoreSee Less Families love our light-and-bright decor, on-site Mar 14, 2024 · View The Obituary For Gaylord John Mlsna of Sparta, Tennessee. Please join us in Loving, Sharing and Memorializing Randy Gammons on this permanent online memorial. A good start for opening weekend. Apr 21, 2025 · View The Obituary For Thelma June Nash Prater of Sparta, Tennessee. Call us today for pre-planning or custom planning options. Please join us in Loving, Sharing and Memorializing JR Young on this permanent online memorial. Please join us in Loving, Sharing and Memorializing Carol Janette Price on this permanent online memorial. Please join us in Loving, Sharing and Memorializing Cindy Carol Gardner on this permanent online memorial. Guy on this permanent online memorial. Dec 27, 2024 · During this difficult time, Hunter Funeral Home is honored to serve the family of Sherry Lynn Carter. . A native of Hertford Co. Discover detailed obituaries, access complete funeral service information, and express your feelings by leaving condolence messages. net 120 East Bockman Way Sparta, Tennessee 38583 (931) 836-3211 (931) 836-3212 Feb 24, 2025 · View The Obituary For Millie Ashburn of Cookeville, Tennessee. , NC he was born on November 29, 1944 to the late Henry Moore, Sr. com. net 120 East Bockman Way Sparta, Tennessee 38583 (931) 836-3211 (931) 836-3212 Mar 9, 2025 · View The Obituary For Ronnie Wayne Nash of Sparta, Tennessee. A memorial […] Read more Obituaries Jan 24, 2025 · View The Obituary For Garry Gean Burson of Sparta, Tennessee. Oct 23, 2023 · View The Obituary For Randy Gammons of Watertown, Tennessee. Please join us in Loving, Sharing and Memorializing William Robert Harris on this permanent online memorial. Jun 17, 2025 · View The Obituary For Linda Sue Narramore of Sparta, Tennessee. Please join us in Loving, Sharing and Memorializing Doug Austin on this permanent online memorial. Hansel Ray Eller, age 78, of Seneca, South Carolina formerly of Clayton, Georgia, passed away Monday, July 24, 2023 at his residence. Nov 16, 2024 · Several great-nieces and nephews also survive Funeral services will be conducted 10:00am Wednesday, November 20, 2024 from the Chapel of Hunter Funeral Home with burial in Copeland Chapel Cemetery. The family will receive visitors on Thursday, January 16, 2025, from 6-8pm at Hunter Funeral Home. , Clayton, GA 30525. Visit Allnutt Funeral Service – Hunter Chapel to start planning a funeral or cremation today. Carl Sims and Blake Williams will officiate. Please join us in Loving, Sharing and Memorializing Donna Jean Dennis Dilldine on this permanent online memorial. Block" Spruill Aug 7, 2025 Visit Obituary Tahj "GEE" Bazemore Aug 5, 2025 Frederick Jones, 53, passed away Sunday, July 6, 2025. With flexible spaces for funerals and receptions, the funeral home provides a contemporary, comfortable environment for planning services and hosting family and friends. Celebrate the beauty of life by recording your favorite memories or sharing meaningful expressions of support on your loved one's social obituary page. Mar 19, 2025 · View The Obituary For Debbie Hutchings of Cookeville, Tennessee. Please join us in Loving, Sharing and Memorializing Stephanie Ann Bly on this permanent online memorial. Please join us in Loving, Sharing and Memorializing Mary June Brown Mitchell on this permanent online memorial. utxcwvljcqraompkhxetdwgdaapkpqkypeppvqvwnemnaqmyvrsgj
